General Information

  • ID:  hor004339
  • Uniprot ID:  P42634
  • Protein name:  Sialokinin
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Expressed exclusively in the medial lobe of female salivary glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NTGDKFYGLM
  • Length:  10
  • Propeptide:  MNMFITVQIVIVLVLAVLSEAASLPTATERKDAMDEGPNQSDEPEGSVADPSTKDDDYSDSLKQDEKYYKVRLLNTGDKFYGLMG
  • Signal peptide:  MNMFITVQIVIVLVLAVLSEAAS
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasodilatory peptide. May activate macrophages at the site of feeding.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42634-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004339_AF2.pdbhor004339_ESM.pdb

Physical Information

Mass: 130601 Formula: C51H76N12O16S
Absent amino acids: ACEHIPQRSVW Common amino acids: G
pI: 6.34 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -52 Boman Index: -1149
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 764 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  8278354
  • Title:  Sialokinin I and II: Vasodilatory Tachykinins From the Yellow Fever Mosquito Aedes Aegypti